Word Meaning

Find the meaning or definition of a word or phrase in English


Meaning of sequent

- Following; succeeding; in continuance.
- Following as an effect; consequent.
- A follower.
- That which follows as a result; a sequence.
Latest view
tethydanenthuseexsectviallingsimilizecringinglycoordinatedprepossessioncocoascococcusexarationvannermisweeninterplanetaryrefitunderskyconativerangpunkaengrieve
Popular word
artificesnewstrirhblog archdiadenlaevoorgano itepodhemishufflecapcongesting shielddrakecream teamalibudigitiseorthoceras
Random Words
DisrobingChocolateEphemeristFollowingLongheaded AirBlithelySlothSuprapubianUnmuffle ObtundingInspireAidPrunerOptic SapperMexicanChitGirnChafferer