Word Meaning

Find the meaning or definition of a word or phrase in English


Meaning of necessitarianism

- The doctrine of philosophical necessity; the doctrine that results follow by invariable sequence from causes, and esp. that the will is not free, but that human actions and choices result inevitably from motives; deteminism.
Latest view
allegoriescohabitantimpolarilymelanianspawlingespringalafghanitweaksargalalancelydozenthrepleviedselectivemamalukedeputeddilutenessembrocatewaggeryscomberdaunts
Popular word
waftshiplesscicerohunkthwite diableriestonishlitepreceptivescarab pilotstudiostonerootsapotaceousgodhood pearl eyedlocustingjauntedtetartohedraldulcite
Random Words
NecessityIncomprehensibleFauldEmpoverishVerge RundelAllurePlongeChapmanNotopodiums LooseImpersonallyFolkDiscordanceWithout TroyounceSinusFlumeShootRetaliation